PDB entry 1c50

View 1c50 on RCSB PDB site
Description: identification and structural characterization of a novel allosteric binding site of glycogen phosphorylase b
Class: transferase
Keywords: glycogen metabolism, glycogen phosphorylase b, inhibition, central cavity, drug binding site, transferase
Deposited on 1999-12-15, released 1999-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycogen phosphorylase)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489 (0-829)
      • conflict (367)
      • see remark 999 (596)
    Domains in SCOPe 2.07: d1c50a_
  • Heterogens: PLP, CHI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c50A (A:)
    isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
    hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
    ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
    rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndf
    nlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfk
    sskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktc
    aytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslve
    egavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwl
    vlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylere
    ykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapg
    yhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagte
    asgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyy
    dripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyk
    nprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdekip