PDB entry 1c4x

View 1c4x on RCSB PDB site
Description: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1
Class: hydrolase
Keywords: hydrolase, pcb degradation
Deposited on 1999-09-30, released 1999-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.178
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase)
    Species: Rhodococcus sp. [TaxId:101510]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4xA (A:)
    maktveiiekrfpsgtlashalvagdpqspavvllhgagpgahaasnwrpiipdlaenff
    vvapdligfgqseypetypghimswvgmrveqilglmnhfgiekshivgnsmggavtlql
    vveaperfdkvalmgsvgapmnarppelarllafyadprltpyrelihsfvydpenfpgm
    eeivksrfevandpevrriqevmfesmkagmeslvippatlgrlphdvlvfhgrqdrivp
    ldtslyltkhlkhaelvvldrcghwaqlerwdamgpmlmehfraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4xA (A:)
    tveiiekrfpsgtlashalvagdpqspavvllhgagpgahaasnwrpiipdlaenffvva
    pdligfgqseypetypghimswvgmrveqilglmnhfgiekshivgnsmggavtlqlvve
    aperfdkvalmgsvgapmnarppelarllafyadprltpyrelihsfvydpenfpgmeei
    vksrfevandpevrriqevmfesmkagmeslvippatlgrlphdvlvfhgrqdrivpldt
    slyltkhlkhaelvvldrcghwaqlerwdamgpmlmehfra