PDB entry 1c4w

View 1c4w on RCSB PDB site
Description: 1.9 a structure of a-thiophosphonate modified chey d57c
Deposited on 1999-09-28, released 2000-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2002-04-24, with a file datestamp of 2002-04-24.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1c4wa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c4wA (A:)
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm