PDB entry 1c4w

View 1c4w on RCSB PDB site
Description: 1.9 a structure of a-thiophosphonate modified chey d57c
Class: signaling protein
Keywords: Phosphono-CheY, Active Form of the Response Regulator, Chemotaxis, SIGNALING PROTEIN
Deposited on 1999-09-28, released 2000-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06143 (0-127)
    • engineered (55)
  Domains in SCOPe 2.08: d1c4wa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c4wA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
  nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm