PDB entry 1c4t

View 1c4t on RCSB PDB site
Description: catalytic domain from trimeric dihydrolipoamide succinyltransferase
Class: transferase
Keywords: transferase, acyltransferase, ketoglutarate dehydrogenase multienzyme complex
Deposited on 1999-09-22, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.257
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (dihydrolipoamide succinyltransferase)
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: SUCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4ta_
  • Chain 'B':
    Compound: protein (dihydrolipoamide succinyltransferase)
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: SUCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4tb_
  • Chain 'C':
    Compound: protein (dihydrolipoamide succinyltransferase)
    Species: ESCHERICHIA COLI [TaxId:469008]
    Gene: SUCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4tc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4tA (A:)
    arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
    gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
    adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
    drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4tA (A:)
    rsekrvpmrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirlgfms
    fyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgmadie
    kkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaikdrpm
    avngqveilpmmylalsydhrlidgresvgflvtikelledptrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c4tB (B:)
    arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
    gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
    adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
    drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4tB (B:)
    ekrrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirlgfmsfyvka
    vvealkrypevnasivvyhnyfdvsmavstprglvtpvlrdvdtlgmadiekkikelavk
    grdgkltvdltggnftitnggvfgslmstpiinppqsailgmhaikdrpmavngqveilp
    mmylalsydhrlidgresvgflvtikelledptrlll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c4tC (C:)
    arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
    gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
    adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
    drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4tC (C:)
    arsekrvprkrvaerlleaknstamlttfnevnmkpimdlrygeafekrhgirlgfmsfy
    vkavvealkrypevnasidgvvyhnyfdvsmavstprglvtpvlrdvdtlgmadiekkik
    elavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaikdrpmavng
    qveilpmmylalsydhrlidgresvgflvtikelledptrllld