PDB entry 1c4r

View 1c4r on RCSB PDB site
Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing
Class: membrane protein
Keywords: lectin-like, neurobiology, cell-cell adhesion, cell-cell recognition, alternative splicing, membrane protein
Deposited on 1999-09-28, released 2000-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.249
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4ra_
  • Chain 'B':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rb_
  • Chain 'C':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rc_
  • Chain 'D':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rd_
  • Chain 'E':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4re_
  • Chain 'F':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rf_
  • Chain 'G':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rg_
  • Chain 'H':
    Compound: neurexin-I beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4rh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4rA (A:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rA (A:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c4rB (B:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rB (B:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c4rC (C:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rC (C:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c4rD (D:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rD (D:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c4rE (E:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rE (E:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev
    p
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1c4rF (F:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rF (F:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4rG (G:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c4rH (H:)
    ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
    lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
    grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
    vp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4rH (H:)
    hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
    hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
    rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv