PDB entry 1c4q

View 1c4q on RCSB PDB site
Description: mutated shiga-like toxin b subunit (f30a/w34a) complexed with receptor gb3 analogue
Deposited on 1999-08-31, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.17
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c4qa_
  • Chain 'B':
    Domains in SCOP 1.55: d1c4qb_
  • Chain 'C':
    Domains in SCOP 1.55: d1c4qc_
  • Chain 'D':
    Domains in SCOP 1.55: d1c4qd_
  • Chain 'E':
    Domains in SCOP 1.55: d1c4qe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4qA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4qB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4qC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4qD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4qE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelatnranlqslllsaqitgmtvtiktnachng
    ggfsevifr