PDB entry 1c4o

View 1c4o on RCSB PDB site
Description: crystal structure of the DNA nucleotide excision repair enzyme uvrb from thermus thermophilus
Class: replication
Keywords: DNA nucleotide excision repair, uvrabc, helicase, hyperthermostable protein, replication
Deposited on 1999-09-14, released 2000-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA nucleotide excision repair enzyme uvrb
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c4oa1, d1c4oa2
  • Heterogens: BOG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4oA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn
    didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp
    athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv
    enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf
    rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirptglldplvrvkp
    tenqildlmegireraargertlvtvltvrmaeeltsflvehgirarylhheldafkrqa
    lirdlrlghydclvginllregldipevslvaildadkegflrsersliqtigraarnar
    gevwlyadrvseamqraieetnrrralqeaynlehgitpetvrkevravirpegyeeapl
    eadlsgedlreriaelelamwqaaealdferaarlrdeiralearlqgvrapepvpggrk
    rkrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4oA (A:)
    tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
    pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
    sttrslltrrdvivvasvsaiyglgdpreyrarnlvgfvlfpathylspegleeilkeie
    kelwervryfeergevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppyt
    lldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeefle
    rvsqvvfvsatpgpfelahsgrvveqiirptglldplvrvkptenqildlmegireraar
    gertlvtvltvrmaeeltsflvehgirarylhheldafkrqalirdlrlghydclvginl
    lregldipevslvaildadkegflrsersliqtigraarnargevwlyadrvseamqrai
    eetnrrralqeaynlehgitpetv