PDB entry 1c4k

View 1c4k on RCSB PDB site
Description: ornithine decarboxylase mutant (gly121tyr)
Deposited on 1999-08-26, released 2000-02-26
The last revision prior to the SCOP 1.59 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4kA (A:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsilppffkslkeyvsr
    yliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaek
    haarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvy
    lqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynah
    evvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagf
    sqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrkl
    whdllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwha
    yegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsil
    flmtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelh
    dfyknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpy
    ppgvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydae
    vaknddrynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4kA (A:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlefdatvnareietavnnyedsilppffkslkeyvsryl
    iqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaekha
    arvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvylq
    tnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynahev
    vkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagfsq
    tsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrklwh
    dllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwhaye
    gygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsilfl
    mtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelhdf
    yknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpypp
    gvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydaeva
    knddrynn