PDB entry 1c4k

View 1c4k on RCSB PDB site
Description: ornithine decarboxylase mutant (gly121tyr)
Class: lyase
Keywords: decarboxylase, ornithine, lyase
Deposited on 1999-08-26, released 2000-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ornithine decarboxylase)
    Species: Lactobacillus sp. 30A [TaxId:1593]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43099 (0-729)
      • engineered (120)
    Domains in SCOPe 2.07: d1c4ka1, d1c4ka2, d1c4ka3
  • Heterogens: PLP, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c4kA (A:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsilppffkslkeyvsr
    yliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaek
    haarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvy
    lqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynah
    evvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagf
    sqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrkl
    whdllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwha
    yegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsil
    flmtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelh
    dfyknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpy
    ppgvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydae
    vaknddrynn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c4kA (A:)
    ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa
    vtkdaqaisadelkkifhiidlefdatvnareietavnnyedsilppffkslkeyvsryl
    iqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaekha
    arvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvynsalamaggrpvylq
    tnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlaviqlgtydgtiynahev
    vkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagfsq
    tsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrklwh
    dllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrfekgakwhaye
    gygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsilfl
    mtpaetpakmnnlitqllqlqrlieedaplkqvlpsiyaaneeryngytirelcqelhdf
    yknnntftyqkrlflreffpeqgmlpyearqefirnhnklvplnkiegeialegalpypp
    gvfcvapgekwsetavkyftilqdginnfpgfapeiqgvyfkqegdkvvaygevydaeva
    knddrynn