PDB entry 1c4c

View 1c4c on RCSB PDB site
Description: binding of exogenously added carbon monoxide at the active site of the fe-only hydrogenase (cpi) from clostridium pasteurianum
Class: oxidoreductase
Keywords: metalloproteins, [fes] clusters, hydrogen oxidation, proton reduction, oxidoreductase
Deposited on 1999-08-16, released 1999-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fe-only hydrogenase)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1c4ca1, d1c4ca2, d1c4ca3
  • Heterogens: HC0, SF4, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c4cA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykk