PDB entry 1c49

View 1c49 on RCSB PDB site
Description: structural and functional differences of two toxins from the scorpion pandinus imperator
Class: toxin
Keywords: scorpion toxin, potassium channels blockers, alpha-k toxin family, neurotoxin, nmr solution structure
Deposited on 1999-08-17, released 2000-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxin k-beta
    Species: Pandinus imperator [TaxId:55084]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c49a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c49A (A:)
    tisctnekqcyphckketgypnakcmnrkckcfgr