PDB entry 1c48

View 1c48 on RCSB PDB site
Description: mutated shiga-like toxin b subunit (g62t)
Deposited on 1999-08-11, released 2000-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-16, with a file datestamp of 2000-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c48a_
  • Chain 'B':
    Domains in SCOP 1.55: d1c48b_
  • Chain 'C':
    Domains in SCOP 1.55: d1c48c_
  • Chain 'D':
    Domains in SCOP 1.55: d1c48d_
  • Chain 'E':
    Domains in SCOP 1.55: d1c48e_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48A (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48B (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48C (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48D (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48E (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr