PDB entry 1c48

View 1c48 on RCSB PDB site
Description: mutated shiga-like toxin b subunit (g62t)
Class: toxin
Keywords: toxin, receptor binding, protein-carbohydrate recognition, ob-fold
Deposited on 1999-08-11, released 2000-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.196
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (shiga-like toxin I b subunit)
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1c48a_
  • Chain 'B':
    Compound: protein (shiga-like toxin I b subunit)
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1c48b_
  • Chain 'C':
    Compound: protein (shiga-like toxin I b subunit)
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1c48c_
  • Chain 'D':
    Compound: protein (shiga-like toxin I b subunit)
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178
      • engineered (61)
    Domains in SCOPe 2.07: d1c48d_
  • Chain 'E':
    Compound: protein (shiga-like toxin I b subunit)
    Species: Phage h30 [TaxId:12371]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69178 (0-68)
      • engineered (61)
    Domains in SCOPe 2.07: d1c48e_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48A (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48B (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48C (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48D (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c48E (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    gtfsevifr