PDB entry 1c47

View 1c47 on RCSB PDB site
Description: binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
Class: transferase
Keywords: phosphoglucomutase, phosphotransferase with bound reaction intermediate
Deposited on 1999-08-11, released 1999-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-d-glucose 1,6-bisphosphate phosphotransferase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c47a1, d1c47a2, d1c47a3, d1c47a4
  • Chain 'B':
    Compound: alpha-d-glucose 1,6-bisphosphate phosphotransferase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c47b1, d1c47b2, d1c47b3, d1c47b4
  • Heterogens: G16, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c47A (A:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c47B (B:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit