PDB entry 1c46

View 1c46 on RCSB PDB site
Description: mutant human lysozyme with foreign n-terminal residues
Class: hydrolase
Keywords: n-terminal, stability, hydrolase
Deposited on 1999-08-03, released 1999-08-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-130)
      • insertion at n-terminus (0)
    Domains in SCOPe 2.03: d1c46a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c46A (A:)
    gkvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqi
    nsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnr
    dvrqyvqgcgv