PDB entry 1c46

View 1c46 on RCSB PDB site
Description:
Deposited on 1999-08-03, released 1999-08-20
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-18, with a file datestamp of 1999-12-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1c46a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c46A (A:)
    gkvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqi
    nsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnr
    dvrqyvqgcgv