PDB entry 1c45

View 1c45 on RCSB PDB site
Description: mutant human lysozyme with foreign n-terminal residues
Class: hydrolase
Keywords: n-terminal, stability
Deposited on 1999-08-03, released 1999-08-20
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (0)
    Domains in SCOP 1.75: d1c45a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c45A (A:)
    avfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv