PDB entry 1c44

View 1c44 on RCSB PDB site
Description: sterol carrier protein 2 (scp2) from rabbit
Class: lipid binding protein
Keywords: sterol carrier protein, non specific lipid transfer protein, fatty acid binding, fatty acyl coa binding, lipid binding protein
Deposited on 1999-07-02, released 2000-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sterol carrier protein 2)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62742 (0-122)
      • conflict (74)
    Domains in SCOPe 2.07: d1c44a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c44A (A:)
    ssagdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
    vlpnsdkkadctitmadsdllalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgk
    akl