PDB entry 1c44

View 1c44 on RCSB PDB site
Description: sterol carrier protein 2 (scp2) from rabbit
Class: lipid binding protein
Keywords: sterol carrier protein, non specific lipid transfer protein, fatty acid binding, fatty acyl coa binding, lipid binding protein
Deposited on 1999-07-02, released 2000-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (sterol carrier protein 2)
  Species: Oryctolagus cuniculus [TaxId:9986]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O62742 (0-122)
    • conflict (74)
  Domains in SCOPe 2.08: d1c44a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c44A (A:)
  ssagdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
  vlpnsdkkadctitmadsdllalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgk
  akl