PDB entry 1c41

View 1c41 on RCSB PDB site
Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Class: transferase
Keywords: riboflavin biosynthesis, transferase
Deposited on 1999-08-03, released 2000-08-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.248
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41a_
  • Chain 'B':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41b_
  • Chain 'C':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41c_
  • Chain 'D':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41d_
  • Chain 'E':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41e_
  • Chain 'F':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41f_
  • Chain 'G':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41g_
  • Chain 'H':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41h_
  • Chain 'I':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41i_
  • Chain 'J':
    Compound: lumazine synthase
    Species: Magnaporthe grisea [TaxId:148305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c41j_
  • Heterogens: SO4, LMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c41A (A:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41A (A:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c41B (B:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41B (B:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c41C (C:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41C (C:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c41D (D:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41D (D:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c41E (E:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41E (E:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1c41F (F:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41F (F:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c41G (G:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41G (G:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c41H (H:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41H (H:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1c41I (I:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41I (I:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1c41J (J:)
    mhtkgptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgsw
    elpiavqrlysasqlqtpssgpslsagdllgssttdltalptttasstgpfdaliaigvl
    ikgetmhfeyiadsvshglmrvqldtgvpvifgvltvltddqakaragviegshnhgedw
    glaavemgvrrrdwaagkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c41J (J:)
    gptpqqhdgsalrigivharwnetiiepllagtkakllacgvkesnivvqsvpgswelpi
    avqrlysasqlqstgpfdaliaigvlikgetmhfeyiadsvshglmrvqldtgvpvifgv
    ltvltddqakaragviegshnhgedwglaavemgvrrrdwaagkt