PDB entry 1c3x

View 1c3x on RCSB PDB site
Description: purine nucleoside phosphorylase from cellulomonas sp. in complex with 8-iodo-guanine
Deposited on 1999-07-29, released 1999-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-16, with a file datestamp of 1999-12-15.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1c3xa_
  • Chain 'B':
    Domains in SCOP 1.67: d1c3xb_
  • Chain 'C':
    Domains in SCOP 1.67: d1c3xc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xA (A:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xB (B:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xC (C:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr