PDB entry 1c3x

View 1c3x on RCSB PDB site
Description: purine nucleoside phosphorylase from cellulomonas sp. in complex with 8-iodo-guanine
Class: transferase
Keywords: enzyme, purine nucleoside phosphorylase, transferase
Deposited on 1999-07-29, released 1999-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pentosyltransferase
    Species: Cellulomonas sp. [TaxId:40001]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3xa_
  • Chain 'B':
    Compound: pentosyltransferase
    Species: Cellulomonas sp. [TaxId:40001]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3xb_
  • Chain 'C':
    Compound: pentosyltransferase
    Species: Cellulomonas sp. [TaxId:40001]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3xc_
  • Heterogens: PO4, 8IG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xA (A:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xB (B:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3xC (C:)
    pplddpatdpflvaraaadhiaqatgveghdmalvlgsgwggaaellgevvaevptheip
    gfssvtrsirveradgsvrhalvlgsrthlyegkgvravvhgvrtaaatgaetliltngc
    gglnqewgagtpvllsdhinltarsplegptfvdltdvysprlrelahrvdptlpegvya
    qfpgphyetpaevrmagilgadlvgmsttleaiaarhcglevlgvslvtnlaagisptpl
    shaevieagqaagprisalladiakr