PDB entry 1c3w

View 1c3w on RCSB PDB site
Description: bacteriorhodopsin/lipid complex at 1.55 a resolution
Class: ion transport
Keywords: ion pump, membrane protein, retinal protein, lipids, photoreceptor, haloarchaea, 7-transmembrane, serpentine, ion transport, merohedral twinning
Deposited on 1999-07-28, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.158
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin (ground state wild type "br")
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3wa_
  • Heterogens: LI1, SQU, RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3wA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
    ligsegagivplnietllfmvldvsakvgfglillrsraifg