PDB entry 1c3w

View 1c3w on RCSB PDB site
Description: bacteriorhodopsin/lipid complex at 1.55 a resolution
Class: ion transport
Keywords: ion pump, membrane protein, retinal protein, lipids, photoreceptor, haloarchaea, 7-transmembrane, serpentine, ion transport, merohedral twinning
Deposited on 1999-07-28, released 1999-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bacteriorhodopsin (ground state wild type "br")
  Species: Halobacterium salinarum [TaxId:2242]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02945 (0-221)
  Domains in SCOPe 2.08: d1c3wa_
• Heterogens: LI1, SQU, RET, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c3wA (A:)
  tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
  gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
  galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
  ligsegagivplnietllfmvldvsakvgfglillrsraifg