PDB entry 1c3v

View 1c3v on RCSB PDB site
Description: dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with nadph and pdc
Class: oxidoreductase
Keywords: TWO-DOMAIN STRUCTURE, TB Structural Genomics Consortium, TBSGC, Structural Genomics, PSI, Protein Structure Initiative, OXIDOREDUCTASE
Deposited on 1999-07-28, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3va1, d1c3va2
  • Chain 'B':
    Compound: dihydrodipicolinate reductase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3vb1, d1c3vb2
  • Heterogens: NDP, PDC, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3vA (A:)
    mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3vB (B:)
    mrvgvlgakgkvgttmvravaaaddltlsaeldagdplslltdgntevvidfthpdvvmg
    nleflidngihavvgttgftaerfqqveswlvakpntsvliapnfaigavlsmhfakqaa
    rffdsaevielhhphkadapsgtaartakliaearkglppnpdatstslpgargadvdgi
    pvhavrlaglvahqevlfgtegetltirhdsldrtsfvpgvllavrriaerpgltvglep
    lldlh