PDB entry 1c3u

View 1c3u on RCSB PDB site
Description: t. maritima adenylosuccinate lyase
Deposited on 1999-07-28, released 2000-03-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-08, with a file datestamp of 2000-03-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c3ua_
  • Chain 'B':
    Domains in SCOP 1.55: d1c3ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3uA (A:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
    dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
    iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
    dhiferfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3uA (A:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrsamphkknpitcerltglsrmmrayvdpslenialwherdishss
    veryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekglt
    rkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhifer
    fek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c3uB (B:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
    dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
    iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
    dhiferfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3uB (B:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrsamphkknpitcerltglsrmmrayvdpslenialwherdishss
    veryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekglt
    rkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhifer
    fek