PDB entry 1c3u

View 1c3u on RCSB PDB site
Description: t. maritima adenylosuccinate lyase
Class: lyase
Keywords: purine biosynthesis, lyase
Deposited on 1999-07-28, released 2000-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate lyase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3ua_
  • Chain 'B':
    Compound: adenylosuccinate lyase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3ub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3uA (A:)
    mveryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfk
    kieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkef
    cdvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygki
    sgavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriavei
    rhlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwhe
    rdishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllk
    liekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkh
    vdhiferfeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3uA (A:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrsamphkknpitcerltglsrmmrayvdpslenialwherdishss
    veryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekglt
    rkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhifer
    fek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c3uB (B:)
    mveryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfk
    kieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkef
    cdvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygki
    sgavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriavei
    rhlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwhe
    rdishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllk
    liekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkh
    vdhiferfeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3uB (B:)
    veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
    ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
    dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
    gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
    hlqrtevleveepfrsamphkknpitcerltglsrmmrayvdpslenialwherdishss
    veryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekglt
    rkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhifer
    fek