PDB entry 1c3t

View 1c3t on RCSB PDB site
Description: rotamer strain as a determinant of protein structural specificity
Class: de novo protein
Keywords: protein design, hydrophobic core, packing, rotamers, roc, ubiquitin, de novo protein
Deposited on 1999-07-28, released 1999-08-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (1d8 ubiquitin)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-75)
      • mutation (2)
      • mutation (12)
      • mutation (14)
      • mutation (16)
      • mutation (22)
      • mutation (25)
      • mutation (60)
      • mutation (66)
    Domains in SCOPe 2.04: d1c3ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3tA (A:)
    mqlfvktltgktltvelepsdtvenlkakiqdkegippdqqrlifagkqledgrtlsdyn
    lqkestihlvlrlrgg