PDB entry 1c3s

View 1c3s on RCSB PDB site
Description: crystal structure of an hdac homolog complexed with saha
Class: lyase
Keywords: alpha/beta fold, hydroxamic acid, penta-coordinated zinc, charge-relay system, lyase
Deposited on 1999-07-28, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hdlp (histone deacetylase-like protein)
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • GB AAC07100
      • conflict (34)
      • engineered (74)
      • engineered (76)
      • conflict (145)
    Domains in SCOPe 2.07: d1c3sa_
  • Heterogens: ZN, SHH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3sA (A:)
    mkkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllf
    htedyintlmeaersqsvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkg
    nvafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafy
    dtdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfaleksle
    ivkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpy
    alarawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggev
    rkevkdtlekakass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3sA (A:)
    kkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllfh
    tedyintlmeaersqsvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkgn
    vafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafyd
    tdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfalekslei
    vkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpya
    larawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggevr
    kevkdtlekaka