PDB entry 1c3q

View 1c3q on RCSB PDB site
Description: crystal structure of native thiazole kinase in the monoclinic form
Deposited on 1999-07-28, released 1999-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c3qa_
  • Chain 'B':
    Domains in SCOP 1.55: d1c3qb_
  • Chain 'C':
    Domains in SCOP 1.55: d1c3qc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qB (B:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qC (C:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs