PDB entry 1c3p

View 1c3p on RCSB PDB site
Description: crystal structure of an hdac homolog from aquifex aeolicus
Class: lyase
Keywords: alpha/beta fold, lyase
Deposited on 1999-07-28, released 1999-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hdlp (histone deacetylase-like protein))
    Species: Aquifex aeolicus [TaxId:63363]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67135
      • conflict (34)
      • conflict (145)
    Domains in SCOPe 2.07: d1c3pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3pA (A:)
    mkkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllf
    htedyintlmeaercqcvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkg
    nvafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafy
    dtdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfaleksle
    ivkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpy
    alarawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggev
    rkevkdtlekakass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3pA (A:)
    kkvkligtldygkyrypknhplkiprvslllrfkdamnlidekeliksrpatkeelllfh
    tedyintlmeaercqcvpkgarekyniggyenpvsyamftgsslatgstvqaieeflkgn
    vafnpaggmhhafksrangfcyinnpavgieylrkkgfkrilyidldahhcdgvqeafyd
    tdqvfvlslhqspeyafpfekgfleeigegkgkgynlniplpkglndneflfalekslei
    vkevfepevyllqlgtdplledylskfnlsnvaflkafnivrevfgegvylggggyhpya
    larawtliwcelsgrevpeklnnkakellksidfeefddevdrsymletlkdpwrggevr
    kevkdtlekaka