PDB entry 1c3l

View 1c3l on RCSB PDB site
Description: subtilisin-carlsberg complexed with xenon (8 bar)
Class: hydrolase
Keywords: xenon, serine-proteinase, hydrolase
Deposited on 1999-07-28, released 1999-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.162
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin-carlsberg
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00780 (0-272)
      • see remark 999 (101)
      • see remark 999 (127)
      • see remark 999 (159)
      • see remark 999 (210)
    Domains in SCOPe 2.08: d1c3la_
  • Heterogens: CA, XE, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3lA (A:)
    aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
    nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
    inmslggasgstamkqavdnayargvvvvaaagnsgssgstntigypakydsviavgavd
    snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
    sasqvrnrlsstatylgssfyygkglinveaaaq