PDB entry 1c3j

View 1c3j on RCSB PDB site
Description: t4 phage beta-glucosyltransferase: substrate binding and proposed catalytic mechanism
Class: transferase
Keywords: glycosyltransferase, transferase
Deposited on 1999-07-28, released 1999-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.8800000000000001 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c3ja_
  • Heterogens: UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c3jA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnssinffggkpnlailsaqkfmakykskiyylftdirlpfsqswpnvknrpwayl
    yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
    tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
    nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
    nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c3jA (A:)
    mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
    rlivvnsnlailsaqkfmakykskiyylftdirlpfsqsaylyteeellikspikvisqg
    inldiakaahkkvdnviefeyfpieqykihmndfqlskptkktldviyggsfrsgqresk
    mveflfdtglnieffgnarekqfknpkypwtkapvftgkipmnmvseknsqaiaaliigd
    knyndnfitlrvwetmasdavmlideefdtkhriindarfyvnnraelidrvnelkhsdv
    lrkemlsiqhdilnktrakkaewqdafkkaidl