PDB entry 1c3h

View 1c3h on RCSB PDB site
Description: acrp30 calcium complex
Class: signaling protein
Keywords: acrp30 c1q tnf trimer all-beta calcium-bound, signaling protein
Deposited on 1999-07-27, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3ha_
  • Chain 'B':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3hb_
  • Chain 'C':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3hc_
  • Chain 'D':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3hd_
  • Chain 'E':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3he_
  • Chain 'F':
    Compound: 30 kd adipocyte complement-related protein precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c3hf_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hA (A:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hB (B:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hC (C:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hD (D:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hE (E:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3hF (F:)
    aymyrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvy
    mkdvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyad
    nvndstftgfllyhdtn