PDB entry 1c3e

View 1c3e on RCSB PDB site
Description: new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylate in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid.
Class: transferase
Keywords: purine biosynthesis, anti-cancer agent, inhibitor complex, transferase
Deposited on 1999-07-27, released 1999-12-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinamide ribonucleotide transformylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08179 (0-208)
    • PDB 1C3E (0-208)
    Domains in SCOPe 2.08: d1c3ea_
  • Chain 'B':
    Compound: glycinamide ribonucleotide transformylase
    Species: Escherichia coli [TaxId:562]
    Gene: PURN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08179 (0-208)
    • PDB 1C3E (0-208)
    Domains in SCOPe 2.08: d1c3eb_
  • Heterogens: NHR, GAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3eA (A:)
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c3eB (B:)
mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
iswfadgrlkmhenaawldgqrlppqgya