PDB entry 1c3d

View 1c3d on RCSB PDB site
Description: x-ray crystal structure of c3d: a c3 fragment and ligand for complement receptor 2
Class: complement
Keywords: complement, c3, c3d, alpha-alpha barrel
Deposited on 1998-05-19, released 1998-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c3d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01024 (2-293)
      • mutation (16)
    Domains in SCOPe 2.06: d1c3da1, d1c3da2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3dA (A:)
    mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
    tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
    pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
    dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
    syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap