PDB entry 1c39

View 1c39 on RCSB PDB site
Description: structure of cation-dependent mannose 6-phosphate receptor bound to pentamannosyl phosphate
Class: signaling protein
Keywords: receptor, cation dependent mannose 6-phosphate, p-type lect transport, signaling protein
Deposited on 1999-07-25, released 2000-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11456 (0-151)
      • mutation (28)
      • mutation (54)
      • mutation (65)
      • mutation (84)
    Domains in SCOPe 2.07: d1c39a_
  • Chain 'B':
    Compound: Cation-dependent mannose-6-phosphate receptor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11456 (0-151)
      • mutation (28)
      • mutation (54)
      • mutation (65)
      • mutation (84)
    Domains in SCOPe 2.07: d1c39b_
  • Heterogens: MN, P3M, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c39A (A:)
    ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
    glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
    tladnfnpvseergkvqdcfylfemdsslacs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c39B (B:)
    ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
    glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
    tladnfnpvseergkvqdcfylfemdsslacs