PDB entry 1c2y

View 1c2y on RCSB PDB site
Description: crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly
Class: transferase
Keywords: riboflavin biosynthesis, transferase
Deposited on 1999-07-27, released 2000-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.31
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2ya_
  • Chain 'B':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yb_
  • Chain 'C':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yc_
  • Chain 'D':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yd_
  • Chain 'E':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2ye_
  • Chain 'F':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yf_
  • Chain 'G':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yg_
  • Chain 'H':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yh_
  • Chain 'I':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yi_
  • Chain 'J':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yj_
  • Chain 'K':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yk_
  • Chain 'L':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yl_
  • Chain 'M':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2ym_
  • Chain 'N':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yn_
  • Chain 'O':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yo_
  • Chain 'P':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yp_
  • Chain 'Q':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yq_
  • Chain 'R':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yr_
  • Chain 'S':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2ys_
  • Chain 'T':
    Compound: protein (lumazine synthase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XH32 (0-End)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1c2yt_
  • Heterogens: LMZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c2yA (A:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yA (A:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c2yB (B:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yB (B:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c2yC (C:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yC (C:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c2yD (D:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yD (D:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c2yE (E:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yE (E:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1c2yF (F:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yF (F:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c2yG (G:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yG (G:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c2yH (H:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yH (H:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1c2yI (I:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yI (I:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1c2yJ (J:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yJ (J:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1c2yK (K:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yK (K:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1c2yL (L:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yL (L:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1c2yM (M:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yM (M:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1c2yN (N:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yN (N:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1c2yO (O:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yO (O:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1c2yP (P:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yP (P:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1c2yQ (Q:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yQ (Q:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1c2yR (R:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yR (R:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1c2yS (S:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yS (S:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1c2yT (T:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2yT (T:)
    mnelegyvtkaqsfrfaivvarfnefvtrrlmegaldtfkkysvnedidvvwvpgayelg
    vtaqalgksgkyhaivclgavvkgdtshydavvnsassgvlsaglnsgvpcvfgvltcdn
    mdqainraggkagnkgaesaltaiemaslfehhlk