PDB entry 1c2u

View 1c2u on RCSB PDB site
Description: solution structure of [abu3,35]shk12-28,17-32
Class: toxin
Keywords: shk toxin, potassium channel, disulphide bonds, analogues, structure-function, solution structure, nmr
Deposited on 1999-07-27, released 1999-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synthetic peptide analogue of shk toxin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29187 (0-34)
      • engineered (2)
      • engineered (20)
      • engineered (34)
    Domains in SCOPe 2.08: d1c2ua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2uA (A:)
    rsaidtipksrctafqckhsakyrlsfcrktcgta