PDB entry 1c2p

View 1c2p on RCSB PDB site
Description: hepatitis c virus ns5b RNA-dependent RNA polymerase
Class: transferase
Keywords: polymerase RNA-dependent RNA polymerase hepatitis c virus ns5b apoenzyme, transferase
Deposited on 1999-07-26, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26663 (8-End)
      • expression tag (6-7)
      • modified residue (41)
      • modified residue (76)
      • modified residue (144)
      • modified residue (178)
      • modified residue (192)
      • modified residue (220)
      • modified residue (318)
      • conflict (334)
      • conflict (343)
      • modified residue (348)
      • modified residue (419)
      • modified residue (428)
      • modified residue (431)
      • conflict (549)
    Domains in SCOPe 2.06: d1c2pa1, d1c2pa2
  • Chain 'B':
    Compound: RNA-dependent RNA polymerase
    Species: Hepatitis C virus [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26663 (8-End)
      • expression tag (6-7)
      • modified residue (41)
      • modified residue (76)
      • modified residue (144)
      • modified residue (178)
      • modified residue (192)
      • modified residue (220)
      • modified residue (318)
      • conflict (334)
      • conflict (343)
      • modified residue (348)
      • modified residue (419)
      • modified residue (428)
      • modified residue (431)
      • conflict (549)
    Domains in SCOPe 2.06: d1c2pb1, d1c2pb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c2pA (A:)
    ashhhhhhsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtf
    drlqvlddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlssk
    avnhihsvwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekma
    lydvvstlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendir
    veesiyqccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntlt
    cylkasaacraaklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdpp
    qpeydlelitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniim
    yaptlwarmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafsl
    hsyspgeinrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktkl
    kltpipaasqldlsgwfvagysggdiyhslsrarpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2pA (A:)
    hhsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
    svwkdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqv
    vmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdl
    apearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacra
    aklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlelits
    cssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmil
    mthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrv
    asclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaasql
    dlsgwfvagysggdiyhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c2pB (B:)
    ashhhhhhsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtf
    drlqvlddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlssk
    avnhihsvwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekma
    lydvvstlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendir
    veesiyqccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntlt
    cylkasaacraaklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdpp
    qpeydlelitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniim
    yaptlwarmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafsl
    hsyspgeinrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktkl
    kltpipaasqldlsgwfvagysggdiyhslsrarpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c2pB (B:)
    hhsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl
    ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
    svwkdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqv
    vmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdl
    apearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacra
    aklqdctmlvngddlvvicesagvqedaaslrafteamtrysappgdppqpeydlelits
    cssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmil
    mthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrv
    asclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaasql
    dlsgwfvagysggdiyhslsr