PDB entry 1c2n

View 1c2n on RCSB PDB site
Description: cytochrome c2, nmr, 20 structures
Deposited on 1998-04-27, released 1999-03-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1c2n__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2n_ (-)
    gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
    gasgfawteediatyvkdpgaflkeklddkkaktgmafklakggedvaaylasvvk