PDB entry 1c2l

View 1c2l on RCSB PDB site
Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
Class: hydrolase/hydrolase inhibitor
Keywords: zn(II)-mediated serine protease inhibitors, ph dependence, zn(II) affinity stucture-based drug design, serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 1999-07-21, released 2000-07-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1c2la_
  • Heterogens: CA, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2lA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn