PDB entry 1c2k

View 1c2k on RCSB PDB site
Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
Class: hydrolase/hydrolase inhibitor
Keywords: zn(II)-mediated serine protease inhibitors, ph dependence, zn(II) affinity stucture-based drug design, serine protease/inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 1999-07-21, released 2000-07-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trypsin
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOPe 2.01: d1c2ka_
• Heterogens: CA, CL, ZN, ABI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c2kA (A:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn