PDB entry 1c2c

View 1c2c on RCSB PDB site
Description: the structure of oxidized cytochrome $c=2= of rhodospirillum rubrum
Deposited on 1973-03-01, released 1976-12-14
The last revision was dated 1983-09-30, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1c2c_ (-)
    egdaaagekvskkclachtfdqggankvgpnlfgvfentaahkdnyaysesytemkakgl
    twteanlaayvknpkafvleksgdpkakskmtfkltkddeienviaylktlk
    

  • Chain 'p':
    No sequence available.