PDB entry 1c2a

View 1c2a on RCSB PDB site
Description: crystal structure of barley bbi
Class: hydrolase inhibitor
Keywords: all-beta structure, hydrolase inhibitor
Deposited on 1999-07-23, released 1999-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bowman-birk trypsin inhibitor
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12940 (0-119)
      • missing in sws (38)
    Domains in SCOPe 2.06: d1c2aa1, d1c2aa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c2aA (A:)
    krpwkccdeavctrsippictcmdevfecpktckscgpsmgdpsrricqdqyvgdpgpic
    rpweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct