PDB entry 1c28

View 1c28 on RCSB PDB site
Description: the crystal structure of a complment-1q family protein suggests an evolutionary link to tumor necrosis factor
Class: serum protein
Keywords: acrp30 c1q tnf trimer all-beta, serum protein
Deposited on 1999-07-22, released 1999-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (30 kd adipocyte complement-related protein precursor (acrp30))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c28a_
  • Chain 'B':
    Compound: protein (30 kd adipocyte complement-related protein precursor (acrp30))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c28b_
  • Chain 'C':
    Compound: protein (30 kd adipocyte complement-related protein precursor (acrp30))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c28c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c28A (A:)
    myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
    dvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyadnv
    ndstftgfllyhdtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c28A (A:)
    myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
    dvkvslfkkdkavlftydqyqenvdqasgsvllhlevgdqvwlqvyyadnvndstftgfl
    lyhdt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c28B (B:)
    myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
    dvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyadnv
    ndstftgfllyhdtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c28B (B:)
    myrsafsvglpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymkdvkvsl
    fkkdkvlftydqyqekvdqasgsvllhlevgdqvwlqvydstftgfllyhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c28C (C:)
    myrsafsvgletrvtvpnvpirftkifynqqnhydgstgkfycnipglyyfsyhitvymk
    dvkvslfkkdkavlftydqyqeknvdqasgsvllhlevgdqvwlqvygdgdhnglyadnv
    ndstftgfllyhdtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c28C (C:)
    myrsafsvgletrvtvpirftkifynqqnhydgstgkfycnipglyyfsyhitvdvkvsl
    fkkdkavlftqasgsvllhlevgdqvwlqndstftgfllyhd