PDB entry 1c26

View 1c26 on RCSB PDB site
Description: crystal structure of p53 tetramerization domain
Class: gene regulation
Keywords: tetramer, gene regulation
Deposited on 1999-07-22, released 1999-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: p53 tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-31)
  Domains in SCOPe 2.08: d1c26a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c26A (A:)
  geyftlqirgrerfemfrelnealelkdaqag