PDB entry 1c25

View 1c25 on RCSB PDB site
Description: human cdc25a catalytic domain
Deposited on 1998-04-17, released 1998-08-19
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1c25__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c25_ (-)
mligdfskgylfhtvagkhqdlkyispeimasvlngkfanlikefviidcrypyeyeggh
ikgavnlhmeeevedfllkkpivptdgkrvivvfhcefssergprmcryvrerdrlgney
pklhypelyvlkggykeffmkcqsyceppsyrpmhhedfke