PDB entry 1c25

View 1c25 on RCSB PDB site
Description: human cdc25a catalytic domain
Class: hydrolase
Keywords: hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, cdk2
Deposited on 1998-04-17, released 1998-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cdc25a
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC25A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c25a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c25A (A:)
    mligdfskgylfhtvagkhqdlkyispeimasvlngkfanlikefviidcrypyeyeggh
    ikgavnlhmeeevedfllkkpivptdgkrvivvfhcefssergprmcryvrerdrlgney
    pklhypelyvlkggykeffmkcqsyceppsyrpmhhedfke