PDB entry 1c21

View 1c21 on RCSB PDB site
Description: e. coli methionine aminopeptidase: methionine complex
Class: hydrolase
Keywords: product complex, hydrolase
Deposited on 1999-07-22, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine aminopeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07906 (0-End)
      • engineered (173)
    Domains in SCOPe 2.07: d1c21a_
  • Heterogens: CO, NA, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c21A (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c21A (A:)
    aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
    yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
    gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
    qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
    dngceiltlrkddtipaiishd