PDB entry 1c20

View 1c20 on RCSB PDB site
Description: solution structure of the DNA-binding domain from the dead ringer protein
Class: DNA-binding protein
Keywords: DNA-binding domain, arid, at-rich interaction domain, DNA-binding protein
Deposited on 1999-07-22, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dead ringer protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c20a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c20A (A:)
    gwsfeeqfkqvrqlyeinddpkrkeflddlfsfmqkrgtpinrlpimaksvldlyelynl
    viargglvdvinkklwqeiikglhlpssitsaaftlrtqymkylypyecekknlstpael
    qaaidgnr